Cathepsin G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Product Code	Brand	Quantity
18418741	Novus Biologicals NBP2-33498-25ul	25 μL
18731134	Novus Biologicals NBP2-33498	0.1 mL

Description

Cathepsin G Polyclonal specifically detects Cathepsin G in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cathepsin G
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: cathepsin G, CathepsinG, CGCATG, EC 3.4.21, EC 3.4.21.20, MGC23078
• Gene Symbols: CTSG
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: P08311
• Gene ID (Entrez): 1511
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only