CAT3/SLC7A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74144

Product Code. 18238473

Description

CAT3/SLC7A3 Polyclonal specifically detects CAT3/SLC7A3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: CAT3/SLC7A3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATRC3cationic amino acid transporter 3, CAT3, CAT-3Cationic amino acid transporter y+, FLJ14541, MGC20687, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3, Solute carrier family 7 member 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84889
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P70423
• Gene Symbols: SLC7A3
• Immunogen: Synthetic peptides corresponding to the middle region of Slc7a3. Immunizing peptide sequence RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 76%; Chicken: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG