missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAT3/SLC7A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£388.00
Specifications
| Antigen | CAT3/SLC7A3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CAT3/SLC7A3 Polyclonal specifically detects CAT3/SLC7A3 in Mouse samples. It is validated for Western Blot.Specifications
| CAT3/SLC7A3 | |
| Polyclonal | |
| Rabbit | |
| P70423 | |
| 84889 | |
| Synthetic peptides corresponding to the middle region of Slc7a3. Immunizing peptide sequence RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ATRC3cationic amino acid transporter 3, CAT3, CAT-3Cationic amino acid transporter y+, FLJ14541, MGC20687, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3, Solute carrier family 7 member 3 | |
| SLC7A3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title