missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Casein Kinase 1 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | Casein Kinase 1 gamma |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Casein Kinase 1 gamma Polyclonal specifically detects Casein Kinase 1 gamma in Mouse samples. It is validated for Western Blot.Specifications
| Casein Kinase 1 gamma | |
| Polyclonal | |
| Purified | |
| RUO | |
| casein kinase 1, gamma 1, casein kinase I isoform gamma-1, CKI-gamma 1, EC 2.7.11, EC 2.7.11.1 | |
| CSNK1G1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_775277 | |
| 53944 | |
| Synthetic peptide directed towards the middle region of mouse CSNK1G1. Peptide sequence CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title