missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carboxypeptidase A1/CPA1 Antibody (CL6629), Novus Biologicals™
Mouse Monoclonal Antibody
£222.00 - £451.00
Specifications
| Antigen | Carboxypeptidase A1/CPA1 |
|---|---|
| Clone | CL6629 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Host Species | Mouse |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18640221
|
Novus Biologicals
NBP2-76509-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18209129
|
Novus Biologicals
NBP2-76509 |
100 μL |
£451.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Carboxypeptidase A1/CPA1 Monoclonal specifically detects Carboxypeptidase A1/CPA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Carboxypeptidase A1/CPA1 | |
| Monoclonal | |
| Mouse | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| 1357 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL6629 | |
| Unconjugated | |
| Human | |
| carboxypeptidase A1, carboxypeptidase A1 (pancreatic), CPA, EC 3.4.17, EC 3.4.17.1 | |
| CPA1 | |
| IgG1 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title