missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carboxypeptidase A1/CPA1 Antibody (CL6629), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-76509
This item is not returnable.
View return policy
Description
Carboxypeptidase A1/CPA1 Monoclonal specifically detects Carboxypeptidase A1/CPA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Carboxypeptidase A1/CPA1 | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| CPA1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL6629 | |
| Western Blot 1 ug/ml, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| carboxypeptidase A1, carboxypeptidase A1 (pancreatic), CPA, EC 3.4.17, EC 3.4.17.1 | |
| Mouse | |
| 100 μL | |
| 1357 | |
| Human | |
| IgG1 |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur