Carboxypeptidase A1/CPA1 Antibody (CL6629), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-76509

Product Code. 18209129

Description

Carboxypeptidase A1/CPA1 Monoclonal specifically detects Carboxypeptidase A1/CPA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Carboxypeptidase A1/CPA1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: CPA1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL6629
• Dilution: Western Blot 1 ug/ml, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Gene Alias: carboxypeptidase A1, carboxypeptidase A1 (pancreatic), CPA, EC 3.4.17, EC 3.4.17.1
• Host Species: Mouse
• Quantity: 100 μL
• Gene ID (Entrez): 1357
• Target Species: Human
• Isotype: IgG1