missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Carbohydrate Sulfotransferase 1/CHST1/KS6ST |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Carbohydrate Sulfotransferase 1/CHST1/KS6ST Polyclonal specifically detects Carbohydrate Sulfotransferase 1/CHST1/KS6ST in Human samples. It is validated for Western Blot.Specifications
| Carbohydrate Sulfotransferase 1/CHST1/KS6ST | |
| Polyclonal | |
| Rabbit | |
| O43916 | |
| 8534 | |
| Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the middle region of CHST1. Peptide sequence YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6ST, carbohydrate (chondroitin 6/keratan) sulfotransferase 1, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, carbohydrate sulfotransferase 1, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST, KSGAL6ST, KSGal6STEC 2.8.2.21, KSST | |
| CHST1 | |
| IgG | |
| 47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title