Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-62370

Product Code. 18243202

Description

Carbohydrate Sulfotransferase 1/CHST1/KS6ST Polyclonal specifically detects Carbohydrate Sulfotransferase 1/CHST1/KS6ST in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Carbohydrate Sulfotransferase 1/CHST1/KS6ST
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C6ST, carbohydrate (chondroitin 6/keratan) sulfotransferase 1, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, carbohydrate sulfotransferase 1, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST, KSGAL6ST, KSGal6STEC 2.8.2.21, KSST
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43916
• Gene Symbols: CHST1
• Immunogen: Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the middle region of CHST1. Peptide sequence YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8534
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG