missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CaMKV Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CaMKV |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CaMKV Polyclonal specifically detects CaMKV in Human samples. It is validated for Western Blot.Specifications
| CaMKV | |
| Polyclonal | |
| Rabbit | |
| Neuronal Cell Markers, Neurotransmission | |
| 1G5, CaM kinase-like vesicle-associated, caM kinase-like vesicle-associated protein, MGC8407, VACAMKL, vesicle-associated calmodulin-binding protein | |
| CAMKV | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NCB2 | |
| 79012 | |
| Synthetic peptides corresponding to CAMKV(CaM kinase-like vesicle-associated) The peptide sequence was selected from the N terminal of CAMKV. Peptide sequence NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title