CaMKV Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56677

Product Code. 18244855

Description

CaMKV Polyclonal specifically detects CaMKV in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CaMKV
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 1G5, CaM kinase-like vesicle-associated, caM kinase-like vesicle-associated protein, MGC8407, VACAMKL, vesicle-associated calmodulin-binding protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NCB2
• Gene Symbols: CAMKV
• Immunogen: Synthetic peptides corresponding to CAMKV(CaM kinase-like vesicle-associated) The peptide sequence was selected from the N terminal of CAMKV. Peptide sequence NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF.
• Quantity: 100 μL
• Research Discipline: Neuronal Cell Markers, Neurotransmission
• Gene ID (Entrez): 79012
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.