missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CaMKK2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | CaMKK2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18367721
|
Novus Biologicals
NBP3-17692-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18357514
|
Novus Biologicals
NBP3-17692-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CaMKK2 Polyclonal antibody specifically detects CaMKK2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CaMKK2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS, pH 7.2, 40% glycerol | |
| 10645 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| calcium/calmodulin-dependent protein kinase kinase 2, calcium/calmodulin-dependent protein kinase kinase 2, beta, Calcium/calmodulin-dependent protein kinase kinase beta, CaM-kinase kinase 2, CaM-kinase kinase beta, CAMKK, CaM-KK 2, CaMKK beta, CaM-KK beta, CAMKK beta protein, CAMKKBCaMKK 2, EC 2.7.11, EC 2.7.11.17, KIAA0787calcium/calmodulin-dependent protein kinase beta, MGC15254 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title