CaMKK2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17692-25UL

Product Code. 18367721

Description

CaMKK2 Polyclonal antibody specifically detects CaMKK2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: CaMKK2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: calcium/calmodulin-dependent protein kinase kinase 2, calcium/calmodulin-dependent protein kinase kinase 2, beta, Calcium/calmodulin-dependent protein kinase kinase beta, CaM-kinase kinase 2, CaM-kinase kinase beta, CAMKK, CaM-KK 2, CaMKK beta, CaM-KK beta, CAMKK beta protein, CAMKKBCaMKK 2, EC 2.7.11, EC 2.7.11.17, KIAA0787calcium/calmodulin-dependent protein kinase beta, MGC15254
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES
• Quantity: 25 μg
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 10645
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified