missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CaMKK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38627-100ul
This item is not returnable.
View return policy
Description
CaMKK2 Polyclonal antibody specifically detects CaMKK2 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| CaMKK2 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| calcium/calmodulin-dependent protein kinase kinase 2, calcium/calmodulin-dependent protein kinase kinase 2, beta, Calcium/calmodulin-dependent protein kinase kinase beta, CaM-kinase kinase 2, CaM-kinase kinase beta, CAMKK, CaM-KK 2, CaMKK beta, CaM-KK beta, CAMKK beta protein, CAMKKBCaMKK 2, EC 2.7.11, EC 2.7.11.17, KIAA0787calcium/calmodulin-dependent protein kinase beta, MGC15254 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CaMKK2 (NP_006540.3).,, Sequence:, MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLS | |
| 100 μL | |
| Protein Kinase | |
| 10645 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction