missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CaMKK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | CaMKK2 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227399
|
Novus Biologicals
NBP3-38627-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228110
|
Novus Biologicals
NBP3-38627-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CaMKK2 Polyclonal antibody specifically detects CaMKK2 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| CaMKK2 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.3), 50% glycerol | |
| 10645 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| calcium/calmodulin-dependent protein kinase kinase 2, calcium/calmodulin-dependent protein kinase kinase 2, beta, Calcium/calmodulin-dependent protein kinase kinase beta, CaM-kinase kinase 2, CaM-kinase kinase beta, CAMKK, CaM-KK 2, CaMKK beta, CaM-KK beta, CAMKK beta protein, CAMKKBCaMKK 2, EC 2.7.11, EC 2.7.11.17, KIAA0787calcium/calmodulin-dependent protein kinase beta, MGC15254 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CaMKK2 (NP_006540.3).,, Sequence:, MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title