missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calnexin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£305.00 - £435.00
Specifications
| Antigen | Calnexin |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18446081
|
Novus Biologicals
NBP1-85520 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18420192
|
Novus Biologicals
NBP1-85520-25ul |
25 μL |
£305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Calnexin Polyclonal antibody specifically detects Calnexin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Calnexin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| ER Markers, Neuroscience, Unfolded Protein Response, Vision | |
| PBS (pH 7.2) and 40% Glycerol | |
| 821 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| calnexin, CNX, IP90FLJ26570, Major histocompatibility complex class I antigen-binding protein p88, P90 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title