missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calnexin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85520-25ul
This item is not returnable.
View return policy
Description
Calnexin Polyclonal antibody specifically detects Calnexin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Calnexin | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| calnexin, CNX, IP90FLJ26570, Major histocompatibility complex class I antigen-binding protein p88, P90 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI | |
| 25 μL | |
| ER Markers, Neuroscience, Unfolded Protein Response, Vision | |
| 821 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction