missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CALML3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CALML3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CALML3 Polyclonal specifically detects CALML3 in Human samples. It is validated for Western Blot.Specifications
| CALML3 | |
| Polyclonal | |
| Rabbit | |
| NP_005176 | |
| 810 | |
| The immunogen for this antibody is CALML3. Peptide sequence TVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| calmodulin-like 3, calmodulin-like protein 3, CaM-like protein, CLPCalmodulin-related protein NB-1 | |
| CALML3 | |
| IgG | |
| 16 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title