missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CALML3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79929
This item is not returnable.
View return policy
Description
CALML3 Polyclonal specifically detects CALML3 in Human samples. It is validated for Western Blot.
Specifications
| CALML3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| calmodulin-like 3, calmodulin-like protein 3, CaM-like protein, CLPCalmodulin-related protein NB-1 | |
| Rabbit | |
| 16 kDa | |
| 100 μL | |
| Signal Transduction | |
| 810 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_005176 | |
| CALML3 | |
| The immunogen for this antibody is CALML3. Peptide sequence TVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTR. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Pig: 92%. | |
| Human, Rat, Pig, Yeast | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction