Calcineurin A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57844

Product Code. 18271285

Description

Calcineurin A Polyclonal specifically detects Calcineurin A in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Calcineurin A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, CALN, CALNAcatalytic subunit, alpha isoform, CAM-PRP catalytic subunit, CNA, CNA1CALNA1, EC 3.1.3.16, PPP2BCCN1, protein phosphatase 2B, catalytic subunit, alpha isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform(calcineurin A alpha), protein phosphatase 3, catalytic subunit, alpha isozyme, serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P63329
• Gene Symbols: PPP3CA
• Immunogen: Synthetic peptides corresponding to PPP3CA(protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform) The peptide sequence was selected from the N terminal of PPP3CA. Peptide sequence MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Adaptive Immunity, Immunology, Protein Phosphatase, Wnt Signaling Pathway
• Gene ID (Entrez): 5530
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.