missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cadherin-22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | Cadherin-22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Cadherin-22 Polyclonal specifically detects Cadherin-22 in Human samples. It is validated for Western Blot.Specifications
| Cadherin-22 | |
| Polyclonal | |
| Purified | |
| RUO | |
| 64405 | |
| Synthetic peptides corresponding to CDH22(cadherin-like 22) The peptide sequence was selected from the N terminal of CDH22. Peptide sequence LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| C20orf25, cadherin 22, type 2, cadherin-22, cadherin-like 22, dJ998H6.1, MGC39564, ortholog of rat PB-cadherin, PB-cadherin, Pituitary and brain cadherin | |
| CDH22 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title