Cadherin-22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-60069

Product Code. 18278363

Description

Cadherin-22 Polyclonal specifically detects Cadherin-22 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cadherin-22
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CDH22
• Immunogen: Synthetic peptides corresponding to CDH22(cadherin-like 22) The peptide sequence was selected from the N terminal of CDH22. Peptide sequence LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Rabbit: 100%; Rat: 100%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C20orf25, cadherin 22, type 2, cadherin-22, cadherin-like 22, dJ998H6.1, MGC39564, ortholog of rat PB-cadherin, PB-cadherin, Pituitary and brain cadherin
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64405
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG