missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CABP7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £369.00
Specifications
| Antigen | CABP7 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18604862
|
Novus Biologicals
NBP2-92722-0.02ml |
0.02 mL |
£161.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678532
|
Novus Biologicals
NBP2-92722-0.1ml |
0.1 mL |
£369.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CABP7 Polyclonal antibody specifically detects CABP7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CABP7 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 164633 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CaBP7, calcium binding protein 7, calcium-binding protein 7, CALN2, calneuron 2, Calneuron II, calneuron-2, MGC57793 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1). PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title