missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CABP7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92722-0.1ml
This item is not returnable.
View return policy
Description
CABP7 Polyclonal antibody specifically detects CABP7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CABP7 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin | |
| CaBP7, calcium binding protein 7, calcium-binding protein 7, CALN2, calneuron 2, Calneuron II, calneuron-2, MGC57793 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1). PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI | |
| 0.1 mL | |
| Neuroscience, Signal Transduction | |
| 164633 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction