missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAB39L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CAB39L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CAB39L Polyclonal specifically detects CAB39L in Human samples. It is validated for Western Blot.Specifications
| CAB39L | |
| Polyclonal | |
| Rabbit | |
| Q9H9S4 | |
| 81617 | |
| Synthetic peptides corresponding to the N terminal of CAB39L. Immunizing peptide sequence EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Antigen MLAA-34, bA103J18.3, calcium binding protein 39-like, calcium-binding protein 39-like, FLJ12577, MO25-BETA, Mo25-like protein, MO2L, RP11-103J18.3, sarcoma antigen NY-SAR-79, U937-associated antigen | |
| CAB39L | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title