CAB39L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74079

Product Code. 18205115

Description

CAB39L Polyclonal specifically detects CAB39L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CAB39L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Antigen MLAA-34, bA103J18.3, calcium binding protein 39-like, calcium-binding protein 39-like, FLJ12577, MO25-BETA, Mo25-like protein, MO2L, RP11-103J18.3, sarcoma antigen NY-SAR-79, U937-associated antigen
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: .
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H9S4
• Gene Symbols: CAB39L
• Immunogen: Synthetic peptides corresponding to the N terminal of CAB39L. Immunizing peptide sequence EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81617
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.