missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C2orf55 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C2orf55 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C2orf55 Polyclonal specifically detects C2orf55 in Human samples. It is validated for Western Blot.Specifications
| C2orf55 | |
| Polyclonal | |
| Rabbit | |
| chromosome 2 open reading frame 55, hypothetical protein LOC343990, KIAA1211L, KIAA1211-like | |
| KIAA1211L | |
| IgG | |
| 102 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 343990 | |
| Synthetic peptides corresponding to C2ORF55 The peptide sequence was selected from the middle region of C2ORF55. Peptide sequence ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title