missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BXDC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | BXDC5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BXDC5 Polyclonal specifically detects BXDC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| BXDC5 | |
| Polyclonal | |
| Rabbit | |
| NP_079341 | |
| 80135 | |
| Synthetic peptide directed towards the N terminal of human BXDC5. Peptide sequence AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| 2310066N05Rik, BBR140, brix domain containing 5, Brix domain-containing protein 5, BXDC5, DKFZp761G0415, DKFZp761M0215, FLJ12475, Ribosome biogenesis protein RPF1, ribosome production factor 1, ribosome production factor 1 homolog (S. cerevisiae), RNA processing factor 1 (RPF1), RP11-118B23.1 | |
| RPF1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title