missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BXDC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80467
This item is not returnable.
View return policy
Description
BXDC5 Polyclonal specifically detects BXDC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| BXDC5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 2310066N05Rik, BBR140, brix domain containing 5, Brix domain-containing protein 5, BXDC5, DKFZp761G0415, DKFZp761M0215, FLJ12475, Ribosome biogenesis protein RPF1, ribosome production factor 1, ribosome production factor 1 homolog (S. cerevisiae), RNA processing factor 1 (RPF1), RP11-118B23.1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 80135 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| NP_079341 | |
| RPF1 | |
| Synthetic peptide directed towards the N terminal of human BXDC5. Peptide sequence AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Rat: 100%; Sumatran orangutan: 100%; Mouse: 100%; Human: 100%; Nine-banded armadillo: 92%; Canine: 92%; Phytophthora infestans T30-4: 84%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction