missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Bub3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Bub3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Bub3 Polyclonal specifically detects Bub3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
| Bub3 | |
| Unconjugated | |
| RUO | |
| O43684 | |
| 9184 | |
| Synthetic peptides corresponding to BUB3(BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast)) The peptide sequence was selected from the N terminal of BUB3 (NP_001007794). Peptide sequence MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers | |
| BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog, BUB3 budding uninhibited by benzimidazoles 3 homolog, BUB3L, budding uninhibited by benomyl, budding uninhibited by benzimidazoles 3 homolog (yeast), hBUB3, mitotic checkpoint component, mitotic checkpoint protein BUB3 | |
| BUB3 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title