Bub3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58206

Product Code. 18259254

Description

Bub3 Polyclonal specifically detects Bub3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Bub3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog, BUB3 budding uninhibited by benzimidazoles 3 homolog, BUB3L, budding uninhibited by benomyl, budding uninhibited by benzimidazoles 3 homolog (yeast), hBUB3, mitotic checkpoint component, mitotic checkpoint protein BUB3
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers
• Gene ID (Entrez): 9184
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Accession No.: O43684
• Gene Symbols: BUB3
• Immunogen: Synthetic peptides corresponding to BUB3(BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast)) The peptide sequence was selected from the N terminal of BUB3 (NP_001007794). Peptide sequence MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG