BRUNOL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18343123	Bio-Techne NBP3-17810-25UL	25 μg
18317935	Novus Biologicals NBP3-17810-100UL	100 μg

Description

BRUNOL4 Polyclonal antibody specifically detects BRUNOL4 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: BRUNOL4
• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Bruno (Drosophila) -like 4, RNA binding protein, BRUNOL-4, BRUNOL4Bruno -like 4, RNA binding protein, bruno-like 4, RNA binding protein, bruno-like 4, RNA binding protein (Drosophila), Bruno-like protein 4, CELF-4, CUG-BP and ETR-3 like factor 4, CUG-BP- and ETR-3-like factor 4, CUGBP Elav-like family member 4, CUGBP, Elav-like family member 4, LYST-interacting protein LIP9, RNA-binding protein BRUNOL4, RNA-binding protein BRUNOL-4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, 40% glycerol
• Gene ID (Entrez): 56853
• Isotype: IgG
• Purification Method: Affinity purified