missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRUNOL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17810-25UL
This item is not returnable.
View return policy
Description
BRUNOL4 Polyclonal antibody specifically detects BRUNOL4 in Human samples. It is validated for Immunofluorescence
Specifications
| BRUNOL4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Bruno (Drosophila) -like 4, RNA binding protein, BRUNOL-4, BRUNOL4Bruno -like 4, RNA binding protein, bruno-like 4, RNA binding protein, bruno-like 4, RNA binding protein (Drosophila), Bruno-like protein 4, CELF-4, CUG-BP and ETR-3 like factor 4, CUG-BP- and ETR-3-like factor 4, CUGBP Elav-like family member 4, CUGBP, Elav-like family member 4, LYST-interacting protein LIP9, RNA-binding protein BRUNOL4, RNA-binding protein BRUNOL-4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 56853 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction