missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BMP-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56251-25ul
This item is not returnable.
View return policy
Description
BMP-2 Polyclonal specifically detects BMP-2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| BMP-2 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| BMP-2, BMP-2A, BMP2ABone morphogenetic protein 2A, bone morphogenetic protein 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| BMP2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS | |
| 25 μL | |
| Cytokine Research, Embryonic Stem Cell Markers, Immunology, Neuronal Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers, Stem Cell Signaling Pathway | |
| 650 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction