Blood Group B Transferase/GTB/ABO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74152

Product Code. 18263125

Description

Blood Group B Transferase/GTB/ABO Polyclonal specifically detects Blood Group B Transferase/GTB/ABO in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Blood Group B Transferase/GTB/ABO
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: A transferase, A3GALNT, A3GALT1, ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase;transferase B, alpha 1-3-galactosyltransferase), ABO glycosyltransferase, B transferase, B(A) alpha-1,3-galactosyltransferase, EC 2.4.1.37, EC 2.4.1.40, Fucosylglycoprotein 3-alpha-galactosyltransferase, Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase, Glycoprotein-fucosylgalactoside alpha-galactosyltransferase, Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase, GTB, Histo-blood group A transferase, histo-blood group A2 transferase, histo-blood group ABO system transferase, Histo-blood group B transferase, NAGAT
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 28
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P38649
• Gene Symbols: ABO
• Immunogen: Synthetic peptides corresponding to the middle region of Abo. Immunizing peptide sequence GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat
• Isotype: IgG