missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BCKDK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | BCKDK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BCKDK Polyclonal specifically detects BCKDK in Human samples. It is validated for Western Blot.Specifications
| BCKDK | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| BCKDHKIN, branched chain alpha-ketoacid dehydrogenase kinase, branched chain ketoacid dehydrogenase kinase, EC 2.7.11, EC 2.7.11.4, mitochondrial | |
| BCKDK | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O14874 | |
| 10295 | |
| Synthetic peptides corresponding to BCKDK(branched chain ketoacid dehydrogenase kinase) The peptide sequence was selected from the N terminal of BCKDK. Peptide sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title