BCKDK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57574

Product Code. 18271064

Description

BCKDK Polyclonal specifically detects BCKDK in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BCKDK
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BCKDHKIN, branched chain alpha-ketoacid dehydrogenase kinase, branched chain ketoacid dehydrogenase kinase, EC 2.7.11, EC 2.7.11.4, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Pig: 100%; Canine: 92%; Equine: 91%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O14874
• Gene Symbols: BCKDK
• Immunogen: Synthetic peptides corresponding to BCKDK(branched chain ketoacid dehydrogenase kinase) The peptide sequence was selected from the N terminal of BCKDK. Peptide sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 10295
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.