missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BCAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | BCAT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BCAT1 Polyclonal specifically detects BCAT1 in Human samples. It is validated for Western Blot.Specifications
| BCAT1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| BCAT(c), BCATC, BCT1PNAS121, branched chain amino-acid transaminase 1, cytosolic, branched chain aminotransferase 1, cytosolic, branched-chain-amino-acid aminotransferase, cytosolic, DKFZp686E12175, EC 2.6.1.42, ECA39, MECA39, placental protein 18, PP18, Protein ECA39 | |
| BCAT1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P54687 | |
| 586 | |
| Synthetic peptides corresponding to BCAT1(branched chain aminotransferase 1, cytosolic) The peptide sequence was selected from the N terminal of BCAT1. Peptide sequence MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title