BCAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58142

Product Code. 18248342

Description

BCAT1 Polyclonal specifically detects BCAT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BCAT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BCAT(c), BCATC, BCT1PNAS121, branched chain amino-acid transaminase 1, cytosolic, branched chain aminotransferase 1, cytosolic, branched-chain-amino-acid aminotransferase, cytosolic, DKFZp686E12175, EC 2.6.1.42, ECA39, MECA39, placental protein 18, PP18, Protein ECA39
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Rabbit: 100%; Equine: 92%; Chicken: 91%; Sheep: 91%; Mouse: 84%.
• Target Species: Human, Mouse, Pig, Canine, Equine, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P54687
• Gene Symbols: BCAT1
• Immunogen: Synthetic peptides corresponding to BCAT1(branched chain aminotransferase 1, cytosolic) The peptide sequence was selected from the N terminal of BCAT1. Peptide sequence MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 586
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.