missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £451.00
Specifications
| Antigen | BAP1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18244462
|
Novus Biologicals
NBP2-55462 |
100 μL |
£451.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18622029
|
Novus Biologicals
NBP2-55462-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BAP1 Polyclonal specifically detects BAP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| BAP1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, DNA Repair, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8314 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase), BRCA1-associated protein 1, Cerebral protein 6, cerebral protein-13, cerebral protein-6, DKFZp686N04275, EC 3.4.19.12, FLJ35406, FLJ37180, hucep-6, KIAA0272HUCEP-13, ubiquitin carboxyl-terminal hydrolase BAP1, ubiquitin carboxy-terminal hydrolase, UCHL2 | |
| BAP1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title