BAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55462

Product Code. 18244462

Description

BAP1 Polyclonal specifically detects BAP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BAP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase), BRCA1-associated protein 1, Cerebral protein 6, cerebral protein-13, cerebral protein-6, DKFZp686N04275, EC 3.4.19.12, FLJ35406, FLJ37180, hucep-6, KIAA0272HUCEP-13, ubiquitin carboxyl-terminal hydrolase BAP1, ubiquitin carboxy-terminal hydrolase, UCHL2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BAP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKP
• Quantity: 100 μL
• Research Discipline: Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, DNA Repair, Tumor Suppressors
• Gene ID (Entrez): 8314
• Target Species: Human
• Isotype: IgG

For Research Use Only