missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B-Raf Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £409.00
Specifications
| Antigen | B-Raf |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18235305
|
Novus Biologicals
NBP2-58818 |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18637978
|
Novus Biologicals
NBP2-58818-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
B-Raf Polyclonal specifically detects B-Raf in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| B-Raf | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| 94 kDa B-raf protein, B-Raf proto-oncogene serine/threonine-protein kinase (p94), B-RAF1, BRAF1MGC126806, EC 2.7.11.1, MGC138284, murine sarcoma viral (v-raf) oncogene homolog B1, NS7, p94, Proto-oncogene B-Raf, RAFB1, serine/threonine-protein kinase B-raf, v-raf murine sarcoma viral oncogene homolog B1FLJ95109 | |
| BRAF | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 673 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title