B-Raf Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58818-25ul

Product Code. 18637978

Description

B-Raf Polyclonal specifically detects B-Raf in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: B-Raf
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 94 kDa B-raf protein, B-Raf proto-oncogene serine/threonine-protein kinase (p94), B-RAF1, BRAF1MGC126806, EC 2.7.11.1, MGC138284, murine sarcoma viral (v-raf) oncogene homolog B1, NS7, p94, Proto-oncogene B-Raf, RAFB1, serine/threonine-protein kinase B-raf, v-raf murine sarcoma viral oncogene homolog B1FLJ95109
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BRAF
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 673
• Target Species: Human
• Form: Purified

For Research Use Only