missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AZI2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£180.00 - £409.00
Specifications
| Antigen | AZI2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231672
|
Novus Biologicals
NBP3-33293-20ul |
20 μL |
£180.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228444
|
Novus Biologicals
NBP3-33293-100ul |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AZI2 Monoclonal antibody specifically detects AZI2 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| AZI2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| 5-azacytidine induced 2, AZ25-azacytidine-induced protein 2, FLJ21939, NAP15-azacytidine induced gene 2, NF-kappa-B-activating kinase-associated protein 1, TILPNak-associated protein 1 | |
| Recombinant protein containing a sequence corresponding to amino acids 282-387 of human AZI2 (NP_071906.1).,, Sequence:, YTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWVFPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 64343 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title