ATPase Inhibitory Factor 1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92891-0.02ml

Product Code. 18688632

Description

ATPase Inhibitory Factor 1 Polyclonal antibody specifically detects ATPase Inhibitory Factor 1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Specifications

• Antigen: ATPase Inhibitory Factor 1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunoprecipitation 1:1000 - 1:5000
• Gene Alias: ATP synthase inhibitor protein, ATPase inhibitor protein, ATPase inhibitor, mitochondrial, ATPase inhibitory factor 1, ATPIIF(1), ATPIP, IF1, Inhibitor of F(1)F(o)-ATPase, IP, MGC1167, MGC8898
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
• Quantity: 0.02 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 93974
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence, Immunoprecipitation
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified