ATP6V1G2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79685

Product Code. 18267465

Description

ATP6V1G2 Polyclonal specifically detects ATP6V1G2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6V1G2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP6G2, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2, Em:AC004181.3, subunit G2, vacuolar ATP synthase subunit G 2, vacuolar proton pump G subunit 2, Vacuolar proton pump subunit G 2, V-ATPase 13 kDa subunit 2, V-ATPase subunit G 2, Vma10, V-type proton ATPase subunit G 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 13 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Horse: 86%; Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_569730
• Gene Symbols: ATP6V1G2
• Immunogen: Synthetic peptide directed towards the middle region of human ATP6V1G2The immunogen for this antibody is ATP6V1G2. Peptide sequence NLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 534
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.