missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88895-25ul
This item is not returnable.
View return policy
Description
ATP6V1D Polyclonal specifically detects ATP6V1D in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ATP6V1D | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| ATP6M, ATPase, H+ transporting lysosomal, member M, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D, H(+)-transporting two-sector ATPase, subunit M, vacuolar ATP synthase subunit D, vacuolar H-ATPase subunit D, vacuolar proton pump D subunit, vacuolar proton pump delta polypeptide, Vacuolar proton pump subunit D, vacuolar proton-ATPase subunit D, VATDV-ATPase D subunit, V-ATPase 28 kDa accessory protein, V-ATPase subunit D, VMA8, V-type proton ATPase subunit D | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51382 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATP6V1D | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAE | |
| 25 μL | |
| Primary | |
| Specificity of human ATP6V1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction