ATP6V1D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18414291	Novus Biologicals NBP1-88895-25ul	25 μL
18290887	Novus Biologicals NBP1-88895	0.1 mL

Description

ATP6V1D Polyclonal specifically detects ATP6V1D in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP6V1D
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51382
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: ATP6M, ATPase, H+ transporting lysosomal, member M, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D, H(+)-transporting two-sector ATPase, subunit M, vacuolar ATP synthase subunit D, vacuolar H-ATPase subunit D, vacuolar proton pump D subunit, vacuolar proton pump delta polypeptide, Vacuolar proton pump subunit D, vacuolar proton-ATPase subunit D, VATDV-ATPase D subunit, V-ATPase 28 kDa accessory protein, V-ATPase subunit D, VMA8, V-type proton ATPase subunit D
• Gene Symbols: ATP6V1D
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human ATP6V1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only