ATP6V1C1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18633870	Novus Biologicals NBP2-92401-0.02ml	0.02 mL
18683081	Novus Biologicals NBP2-92401-0.1ml	0.1 mL

Description

ATP6V1C1 Polyclonal antibody specifically detects ATP6V1C1 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: ATP6V1C1
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Endocrinology, Signal Transduction
• Formulation: PBS with 50% glycerol, pH7.3.
• Gene ID (Entrez): 528
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Western Blot 1:500-1:2000
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human, Mouse
• Gene Alias: ATP6CH+-transporting ATPase chain C, vacuolar, ATP6Dsubunit C of vacuolar proton-ATPase V1 domain, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, FLJ20057, H(+)-transporting two-sector ATPase, subunit C, vacuolar ATP synthase subunit C, vacuolar proton pump C subunit, Vacuolar proton pump subunit C 1, vacuolar proton pump, 42-kD subunit, vacuolar proton-ATPase, subunit C, VI domain, VATCH+ -ATPase C subunit, V-ATPase C subunit, V-ATPase subunit C 1, Vma5, V-type proton ATPase subunit C 1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1). LRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
• Primary or Secondary: Primary
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.