ATP6V1B2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54858

Product Code. 18263493

Description

ATP6V1B2 Polyclonal specifically detects ATP6V1B2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6V1B2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 000 subunit, 56/58kD, isoform 2, ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2, Endomembrane proton pump 58 kDa subunit, H+ transporting two-sector ATPase, HO57ATP6B1B2, vacuolar H+-ATPase 56, Vacuolar proton pump subunit B 2, VATB, V-ATPase B2 subunit, V-ATPase subunit B 2, Vma2, VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2, V-type proton ATPase subunit B, brain isoform
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: B, brain isoform.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P21281
• Gene Symbols: ATP6V1B2
• Immunogen: Synthetic peptides corresponding to ATP6V1B2(ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2) The peptide sequence was selected from the middle region of ATP6V1B2. Peptide sequence NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 526
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.