ATOX1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92669-0.1ml

Product Code. 18602302

Description

ATOX1 Polyclonal antibody specifically detects ATOX1 in Human samples. It is validated for Western Blot

Specifications

• Antigen: ATOX1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000
• Gene Alias: ATX1, ATX1 (antioxidant protein 1, yeast) homolog 1, ATX1 antioxidant protein 1 homolog (yeast), copper transport protein ATOX1, hah1, HAH1 MGC138453, Metal transport protein ATX1, MGC138455
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1). MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cell Biology, Golgi Apparatus Markers, Signal Transduction
• Gene ID (Entrez): 475
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified